Tnf (NM_012675) Rat Recombinant Protein

CAT#: TP723453

Purified recombinant protein of Rat tumor necrosis factor (TNF superfamily, member 2) (Tnf).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
• Tag: Tag Free
• Predicted MW: 17.3 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036807
• Locus ID: 24835
• UniProt ID: P16599
• Cytogenetics: 20p12
• Refseq Size: 1687
• Refseq ORF: 705
• Synonyms: RATTNF; TNF-alpha; Tnfa
• Summary: acts as a cytokine; binds TNF receptors; plays a role in regulation of cell proliferation, induction of apoptosis, and inflammatory response [RGD, Feb 2006]