DUT (NM_001025248) Human Recombinant Protein
CAT#: TP720892
Purified recombinant protein of Human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
|
Tag | Tag Free |
Predicted MW | 17.7 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of PBS, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001020419 |
Locus ID | 1854 |
UniProt ID | P33316 |
Cytogenetics | 15q21.1 |
Refseq Size | 2146 |
Refseq ORF | 756 |
Synonyms | dUTPase |
Summary | 'This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400715 | DUT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422498 | DUT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425493 | DUT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400715 | Transient overexpression lysate of deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 325.00 |
|
LY422498 | Transient overexpression lysate of deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 325.00 |
|
LY425493 | Transient overexpression lysate of deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 325.00 |
|
PH310600 | DUT MS Standard C13 and N15-labeled recombinant protein (NP_001020420) |
USD 2,055.00 |
|
PH321635 | DUT MS Standard C13 and N15-labeled recombinant protein (NP_001939) |
USD 2,055.00 |
|
TP310600 | Purified recombinant protein of Homo sapiens deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 823.00 |
|
TP321635 | Recombinant protein of human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review