NANS (NM_018946) Human Recombinant Protein
CAT#: TP720942
Purified recombinant protein of Human N-acetylneuraminic acid synthase (NANS)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MGSSHHHHHHSSGLVPRGSHMPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALDRPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVL
|
Tag | N-His |
Predicted MW | 42 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_061819 |
Locus ID | 54187 |
UniProt ID | Q9NR45 |
Cytogenetics | 9q22.33 |
Refseq Size | 1257 |
Refseq ORF | 1077 |
Synonyms | HEL-S-100; SAS; SEMDCG; SEMDG |
Summary | This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. [provided by RefSeq, Jul 2008] |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412808 | NANS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY412808 | Transient overexpression lysate of N-acetylneuraminic acid synthase (NANS) |
USD 325.00 |
|
PH300123 | NANS MS Standard C13 and N15-labeled recombinant protein (NP_061819) |
USD 2,055.00 |
|
TP300123 | Recombinant protein of human N-acetylneuraminic acid synthase (NANS) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review