Amphiregulin (AREG) (NM_001657) Human Recombinant Protein
CAT#: TP720947
Purified recombinant protein of Human amphiregulin (AREG)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
|
Tag | Tag Free |
Predicted MW | 11.4 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001648 |
Locus ID | 374 |
UniProt ID | P15514 |
Cytogenetics | 4q13.3 |
Refseq Size | 1270 |
Refseq ORF | 756 |
Synonyms | AR; AREGB; CRDGF; SDGF |
Summary | 'The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). The protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells, and it inhibits the growth of certain aggressive carcinoma cell lines. It also functions in mammary gland, oocyte and bone tissue development. This gene is associated with a psoriasis-like skin phenotype, and is also associated with other pathological disorders, including various types of cancers and inflammatory conditions. [provided by RefSeq, Apr 2014]' |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | ErbB signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400625 | AREG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400625 | Transient overexpression lysate of amphiregulin (AREG) |
USD 325.00 |
|
TP723010 | Purified recombinant protein of Human amphiregulin (AREG). |
USD 240.00 |
|
TP761407 | Purified recombinant protein of Human amphiregulin (AREG), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review