PPT1 (NM_000310) Human Recombinant Protein
CAT#: TP721098
Purified recombinant protein of Human palmitoyl-protein thioesterase 1 (PPT1), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
DPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLGVDHHHHHH
|
Tag | C-His |
Predicted MW | 32.3 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000301 |
Locus ID | 5538 |
UniProt ID | P50897 |
Cytogenetics | 1p34.2 |
Refseq Size | 2504 |
Refseq ORF | 918 |
Synonyms | CLN1; INCL; PPT |
Summary | 'The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Fatty acid elongation in mitochondria, Lysosome, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400121 | PPT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC428205 | PPT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400121 | Transient overexpression lysate of palmitoyl-protein thioesterase 1 (PPT1), transcript variant 1 |
USD 325.00 |
|
LY428205 | Transient overexpression lysate of palmitoyl-protein thioesterase 1 (PPT1), transcript variant 2 |
USD 325.00 |
|
TP760080 | Recombinant protein of human palmitoyl-protein thioesterase 1 (PPT1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review