Il13 (NM_008355) Mouse Recombinant Protein

CAT#: TP721157

Purified recombinant protein of Mouse interleukin 13 (Il13)

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
• Tag: Tag Free
• Predicted MW: 11.7 kDa
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_032381
• Locus ID: 16163
• UniProt ID: P20109
• Cytogenetics: 11 31.98 cM
• Refseq Size: 1217
• Refseq ORF: 393
• Synonyms: Il-13