Il13 (NM_008355) Mouse Recombinant Protein
CAT#: TP723191
Purified recombinant protein of Mouse interleukin 13 (Il13).
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
|
Tag | Tag Free |
Predicted MW | 12.3 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | The ED50 as determined by the dose-dependent proliferation of TF-1 cells was > 4.0 ng/ml, corresponding to a specific activity of > 2.5 x 10^5 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_032381 |
Locus ID | 16163 |
UniProt ID | P20109 |
Cytogenetics | 11 31.98 cM |
Refseq Size | 1217 |
Refseq ORF | 393 |
Synonyms | Il-13 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP720598 | Purified recombinant protein of Mouse interleukin 13 (Il13) |
USD 330.00 |
|
TP721157 | Purified recombinant protein of Mouse interleukin 13 (Il13) |
USD 330.00 |
|
TP723188 | Purified recombinant protein of Rat interleukin 13 (Il13). |
USD 240.00 |
|
TP723189 | Purified recombinant protein of Rat interleukin 13 (Il13). |
USD 240.00 |
|
TP723749 | Purified recombinant protein of Mouse interleukin 13 (Il13) |
USD 255.00 |
{0} Product Review(s)
Be the first one to submit a review