Il13 (NM_008355) Mouse Recombinant Protein

CAT#: TP723191

Purified recombinant protein of Mouse interleukin 13 (Il13).


  View other "Il13" proteins (5)

USD 240.00

5 Days*

Size
    • 10 ug

Product Images

Other products for "Il13"

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Tag Tag Free
Predicted MW 12.3 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity The ED50 as determined by the dose-dependent proliferation of TF-1 cells was > 4.0 ng/ml, corresponding to a specific activity of > 2.5 x 10^5 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_032381
Locus ID 16163
UniProt ID P20109
Cytogenetics 11 31.98 cM
Refseq Size 1217
Refseq ORF 393
Synonyms Il-13

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.