Il13 (NM_053828) Rat Recombinant Protein

CAT#: TP723188

Purified recombinant protein of Rat interleukin 13 (Il13).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  VRRSTSPPVALRELIEELSNITQDQKTSLCNSSIVWSVDITAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
• Tag: Tag Free
• Predicted MW: 11.9 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 as determined by the dose-dependant stimulation of the proliferation of human TF-1 cells is > 40 ng/ml, corresponding to a specific activity of > 2.5 x 10^4 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_446280
• Locus ID: 116553
• UniProt ID: P42203
• Cytogenetics: 10q22
• Refseq Size: 443
• Refseq ORF: 393
• Summary: cytokine; involved in inflammatory and immune responses [RGD, Feb 2006]