Il13 (NM_053828) Rat Recombinant Protein
CAT#: TP723188
Purified recombinant protein of Rat interleukin 13 (Il13).
Specifications
Product Data | |
Species | Rat |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
VRRSTSPPVALRELIEELSNITQDQKTSLCNSSIVWSVDITAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
|
Tag | Tag Free |
Predicted MW | 11.9 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 as determined by the dose-dependant stimulation of the proliferation of human TF-1 cells is > 40 ng/ml, corresponding to a specific activity of > 2.5 x 10^4 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_446280 |
Locus ID | 116553 |
UniProt ID | P42203 |
Cytogenetics | 10q22 |
Refseq Size | 443 |
Refseq ORF | 393 |
Summary | cytokine; involved in inflammatory and immune responses [RGD, Feb 2006] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP720598 | Purified recombinant protein of Mouse interleukin 13 (Il13) |
USD 300.00 |
|
TP721157 | Purified recombinant protein of Mouse interleukin 13 (Il13) |
USD 300.00 |
|
TP723189 | Purified recombinant protein of Rat interleukin 13 (Il13). |
USD 240.00 |
|
TP723191 | Purified recombinant protein of Mouse interleukin 13 (Il13). |
USD 240.00 |
|
TP723749 | Purified recombinant protein of Mouse interleukin 13 (Il13) |
USD 255.00 |
{0} Product Review(s)
Be the first one to submit a review