Mif (NM_010798) Mouse Recombinant Protein
CAT#: TP721159
Purified recombinant protein of Mouse macrophage migration inhibitory factor (Mif)
Product Images
Other products for "Mif"
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFALEHHHHHH
|
Tag | C-His |
Predicted MW | 13.4 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_034928 |
Locus ID | 17319 |
UniProt ID | P34884, Q545F0 |
Cytogenetics | 10 C1 |
Refseq Size | 554 |
Refseq ORF | 348 |
Synonyms | DER6; GIF; Glif |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP500478 | Purified recombinant protein of Mouse macrophage migration inhibitory factor (glycosylation-inhibiting factor) (Mif), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
USD 748.00 |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.