APRIL (TNFSF13) (NM_003808) Human Recombinant Protein
CAT#: TP723020
Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 13 (TNFSF13), transcript variant alpha.
Specifications
Product Data | |
Species | Human |
Expression Host | Hi-5 insect |
Expression cDNA Clone or AA Sequence |
AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
|
Tag | Tag Free |
Predicted MW | 16.3 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Measured by its ability to induce cell death in Jurkat cells. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003799 |
Locus ID | 8741 |
UniProt ID | O75888 |
Cytogenetics | 17p13.1 |
Refseq Size | 2276 |
Refseq ORF | 750 |
Synonyms | APRIL; CD256; TALL-2; TALL2; TNLG7B; TRDL-1; UNQ383/PRO715; ZTNF2 |
Summary | The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401250 | TNFSF13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC406830 | TNFSF13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC434048 | TNFSF13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401250 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 13 (TNFSF13), transcript variant alpha |
USD 325.00 |
|
LY406830 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 13 (TNFSF13), transcript variant gamma |
USD 325.00 |
|
LY434048 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 13 (TNFSF13), transcript variant eta |
USD 325.00 |
|
TP761373 | Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 13 (TNFSF13), transcript variant gamma, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review