BCMA (TNFRSF17) (NM_001192) Human Recombinant Protein

CAT#: TP723029

Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 17 (BCMA/TNFRSF17).


  View other "TNFRSF17" proteins (3)

USD 240.00

5 Days*

Size
    • 20 ug

Product Images

Other products for "TNFRSF17"

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Tag Tag Free
Predicted MW 5.3 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_001183
Locus ID 608
UniProt ID Q02223
Cytogenetics 16p13.13
Refseq Size 994
Refseq ORF 552
Synonyms BCM; BCMA; CD269; TNFRSF13A
Summary 'The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. [provided by RefSeq, Jul 2008]'
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.