BCMA (TNFRSF17) (NM_001192) Human Recombinant Protein
CAT#: TP723029
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 17 (BCMA/TNFRSF17).
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
|
| Tag | Tag Free |
| Predicted MW | 5.3 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001183 |
| Locus ID | 608 |
| UniProt ID | Q02223 |
| Cytogenetics | 16p13.13 |
| Refseq Size | 994 |
| Refseq ORF | 552 |
| Synonyms | BCM; BCMA; CD269; TNFRSF13A |
| Summary | 'The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400483 | BCMA/TNFRSF17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400483 | Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 17 (BCMA/TNFRSF17) |
USD 436.00 |
|
| TP700293 | Purified recombinant protein of human tumor necrosis factor receptor superfamily, member 17 (BCMA/TNFRSF17), with C-terminal Fc tag, expressed in human cells, 20 µg |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China