beta Defensin 1 (DEFB1) (NM_005218) Human Recombinant Protein
CAT#: TP723031
Purified recombinant protein of Human defensin, beta 1 (DEFB1).
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
|
Tag | Tag Free |
Predicted MW | 5 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract CD34+ dendritic cells using a concentration range of 100.0-1000.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005209 |
Locus ID | 1672 |
UniProt ID | P60022 |
Cytogenetics | 8p23.1 |
Refseq Size | 484 |
Refseq ORF | 204 |
Synonyms | BD1; DEFB-1; DEFB101; HBD1 |
Summary | 'Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008]' |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401597 | DEFB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401597 | Transient overexpression lysate of defensin, beta 1 (DEFB1) |
USD 325.00 |
|
PH308244 | DEFB1 MS Standard C13 and N15-labeled recombinant protein (NP_005209) |
USD 2,055.00 |
|
TP308244 | Recombinant protein of human defensin, beta 1 (DEFB1) |
USD 439.00 |
|
TP720106 | Recombinant protein of human defensin, beta 1 (DEFB1) |
USD 300.00 |
|
TP723030 | Purified recombinant protein of Human defensin, beta 1 (DEFB1). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review