beta Defensin 1 (DEFB1) (NM_005218) Human Mass Spec Standard

CAT#: PH308244

DEFB1 MS Standard C13 and N15-labeled recombinant protein (NP_005209)

Product Images

Coomassie blue staining of purified DEFB1 protein (Cat# TP308244). The protein was produced from HEK293T cells transfected with DEFB1 cDNA clone (Cat# RC208244) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208244
• Predicted MW: 7.4 kDa
• Protein Sequence:
  Sequence Link

  >RC208244 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005209
• RefSeq Size: 484
• RefSeq ORF: 204
• Synonyms: BD1; DEFB-1; DEFB101; HBD1
• Locus ID: 1672
• UniProt ID: P60022
• Cytogenetics: 8p23.1
• Summary: 'Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008]'
• Protein Families: Secreted Protein