beta Defensin 1 (DEFB1) (NM_005218) Human Mass Spec Standard
CAT#: PH308244
DEFB1 MS Standard C13 and N15-labeled recombinant protein (NP_005209)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208244 |
Predicted MW | 7.4 kDa |
Protein Sequence |
>RC208244 protein sequence
Red=Cloning site Green=Tags(s) MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005209 |
RefSeq Size | 484 |
RefSeq ORF | 204 |
Synonyms | BD1; DEFB-1; DEFB101; HBD1 |
Locus ID | 1672 |
UniProt ID | P60022 |
Cytogenetics | 8p23.1 |
Summary | 'Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008]' |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401597 | DEFB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401597 | Transient overexpression lysate of defensin, beta 1 (DEFB1) |
USD 396.00 |
|
TP308244 | Recombinant protein of human defensin, beta 1 (DEFB1) |
USD 439.00 |
|
TP720106 | Recombinant protein of human defensin, beta 1 (DEFB1) |
USD 330.00 |
|
TP723030 | Purified recombinant protein of Human defensin, beta 1 (DEFB1). |
USD 240.00 |
|
TP723031 | Purified recombinant protein of Human defensin, beta 1 (DEFB1). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review