BD2 (DEFB4A) (NM_004942) Human Recombinant Protein

CAT#: TP723032

Purified recombinant protein of Human defensin, beta 4A (DEFB4A).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
• Tag: Tag Free
• Predicted MW: 4.3 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract immature human dendritic cells using a concentration of 10.0-100.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004933
• Locus ID: 1673
• UniProt ID: O15263
• Cytogenetics: 8p23.1
• Refseq Size: 460
• Refseq ORF: 192
• Synonyms: BD-2; DEFB-2; DEFB2; DEFB4; DEFB102; HBD-2; SAP1
• Summary: 'Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane