Cxcl16 (NM_023158) Mouse Recombinant Protein

CAT#: TP723063

Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 16 (Cxcl16).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP
• Tag: Tag Free
• Predicted MW: 9.9 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract murine lymphocytes using a concentration of 20-1000 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_075647
• Locus ID: 66102
• UniProt ID: Q8BSU2, A2CFE9
• Cytogenetics: 11 B3
• Refseq Size: 2448
• Refseq ORF: 741
• Synonyms: 0910001K24Rik; AV290116; b2b498Clo; BB024863; CXCL16v1; CXCL16v2; SR-PSOX; Zmynd15