Egf (NM_010113) Mouse Recombinant Protein
CAT#: TP723069
Purified recombinant protein of Mouse epidermal growth factor (Egf).
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
|
Tag | Tag Free |
Predicted MW | 6 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | The ED50 was determined by a cell proliferation assay using BALB/c 3T3 cells is less than or equal to 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_034243 |
Locus ID | 13645 |
UniProt ID | P01132, Q3UWD7 |
Cytogenetics | 3 58.5 cM |
Refseq Size | 4757 |
Refseq ORF | 3654 |
Synonyms | AI790464 |
Summary | This gene encodes epidermal growth factor (EGF), the founding member of the EGF family of growth factors that are implicated in cell proliferation and differentiation. The encoded protein can localize to the membrane and function in juxtacrine signaling or undergo proteolytic processing to generate a soluble form of the hormone. Mice lacking the encoded protein do not exhibit an abnormal phenotype but transgenic mice overexpressing the encoded protein exhibit hypospermatogenesis. [provided by RefSeq, Jul 2016] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP511815 | Purified recombinant protein of Mouse epidermal growth factor (Egf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
USD 748.00 |
|
TP721160 | Purified recombinant protein of Mouse epidermal growth factor (cDNA clone MGC:18573 IMAGE:4221592) |
USD 300.00 |
|
TP723070 | Purified recombinant protein of Rat epidermal growth factor (Egf). |
USD 140.00 |
|
TP723822 | Purified recombinant protein of Mouse epidermal growth factor (Egf) |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review