Egf (NM_012842) Rat Recombinant Protein

CAT#: TP723070

Purified recombinant protein of Rat epidermal growth factor (Egf).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
• Tag: Tag Free
• Predicted MW: 6.2 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by a cell proliferation assay using BALB/c 3T3 cells is less than or equal to 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036974
• Locus ID: 25313
• UniProt ID: P07522
• Cytogenetics: 2q21
• Refseq Size: 4801
• Refseq ORF: 3399
• Summary: binds the epidermal growth factor receptor; may play a role in MAP kinase mediated signaling pathways [RGD, Feb 2006]