FGF2 (NM_002006) Human Recombinant Protein
CAT#: TP723110
Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2).
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
|
| Tag | Tag Free |
| Predicted MW | 17.2 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1 x 107 units/mg. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001997 |
| Locus ID | 2247 |
| UniProt ID | P09038 |
| Cytogenetics | 4q28.1 |
| Refseq Size | 6803 |
| Refseq ORF | 864 |
| Synonyms | BFGF; FGF-2; FGFB; HBGF-2 |
| Summary | 'The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400733 | FGF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400733 | Transient overexpression lysate of fibroblast growth factor 2 (basic) (FGF2) |
USD 436.00 |
|
| PH317426 | FGF2 MS Standard C13 and N15-labeled recombinant protein (NP_001997) |
USD 2,055.00 |
|
| TP317426 | Recombinant protein of human fibroblast growth factor 2 (basic) (FGF2) |
USD 748.00 |
|
| TP720037 | Recombinant protein of human fibroblast growth factor 2 (basic) (FGF2) |
USD 330.00 |
|
| TP723719 | Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2) |
USD 140.00 |
|
| TP750002 | Recombinant protein of human Fibroblast Growth Factor-basic (FGF2) produced in E. coli |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China