TNFRSF14 (NM_003820) Human Recombinant Protein

CAT#: TP723158

Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) (TNFRSF14).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: Hi-5 insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Tag: hIgG Fc1
• Predicted MW: 41 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to neutralize 0.25 ng/ml of hTNFβ induced cytotoxicity on murine L929 cells. The expected ED50 for this effect is 1.3-1.9 ug/mL of HVEM-Fc.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003811
• Locus ID: 8764
• UniProt ID: Q92956, A0A024R052
• Cytogenetics: 1p36.32
• Refseq Size: 3519
• Refseq ORF: 849
• Synonyms: ATAR; CD270; HVEA; HVEM; LIGHTR; TR2
• Summary: This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction