IL13 (NM_002188) Human Recombinant Protein

CAT#: TP723190

Purified recombinant protein of Human interleukin 13 (IL13).

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MSPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
• Tag: Tag Free
• Predicted MW: 12.6 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 as determined by the dose-dependent proliferation of TF-1 cells was < 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002179
• Locus ID: 3596
• UniProt ID: P35225
• Cytogenetics: 5q31.1
• Refseq Size: 1282
• Refseq ORF: 438
• Synonyms: IL-13; P600
• Summary: 'This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Asthma, Cytokine-cytokine receptor interaction, Fc epsilon RI signaling pathway, Jak-STAT signaling pathway