IL13 (NM_002188) Human Recombinant Protein
CAT#: TP723192
Purified recombinant protein of Human interleukin 13 (IL13).
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MSPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
|
Tag | Tag Free |
Predicted MW | 13 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | This IL-13 analog shows a two fold increase, relative to wild type IL-13, in bioactivity as measured by the in-vitro dose dependent activation of STAT6 and IL-13 dependent gene induction in transfected A201.1 cells. This analog has also been shown to exhibit increased in vivo activity compared to wild type IL-13, as measured by the induction of airway hyper-responsiveness. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002179 |
Locus ID | 3596 |
UniProt ID | P35225 |
Cytogenetics | 5q31.1 |
Refseq Size | 1282 |
Refseq ORF | 438 |
Synonyms | IL-13; P600 |
Summary | 'This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Asthma, Cytokine-cytokine receptor interaction, Fc epsilon RI signaling pathway, Jak-STAT signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400793 | IL13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400793 | Transient overexpression lysate of interleukin 13 (IL13) |
USD 396.00 |
|
TP700054 | Recombinant protein of secreted form of human interleukin 13 (IL13) |
USD 748.00 |
|
TP723190 | Purified recombinant protein of Human interleukin 13 (IL13). |
USD 240.00 |
|
TP723715 | Purified recombinant protein of Human interleukin 13 (IL13) |
USD 275.00 |
{0} Product Review(s)
Be the first one to submit a review