IL1 alpha (IL1A) (NM_000575) Human Recombinant Protein
CAT#: TP723206
Purified recombinant protein of Human interleukin 1, alpha (IL1A).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
|
Tag | Tag Free |
Predicted MW | 18 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 as determined by the dose-dependent stimulation of murine D10S cells is less than or equal to 0.001 ng/ml, corresponding to a specific activity of > 1 x 10^9 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000566 |
Locus ID | 3552 |
UniProt ID | P01583 |
Cytogenetics | 2q14.1 |
Refseq Size | 2943 |
Refseq ORF | 813 |
Synonyms | IL-1 alpha; IL-1A; IL1; IL1-ALPHA; IL1F1 |
Summary | 'The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Apoptosis, Cytokine-cytokine receptor interaction, Graft-versus-host disease, Hematopoietic cell lineage, MAPK signaling pathway, Prion diseases, Type I diabetes mellitus |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424636 | IL1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY424636 | Transient overexpression lysate of interleukin 1, alpha (IL1A) |
USD 396.00 |
|
TP720056 | Recombinant protein of human interleukin 1, alpha (IL1A) |
USD 330.00 |
|
TP723707 | Purified recombinant protein of Human interleukin 1, alpha (IL1A) |
USD 275.00 |
{0} Product Review(s)
Be the first one to submit a review