IL1 alpha (IL1A) (NM_000575) Human Recombinant Protein

CAT#: TP723206

Purified recombinant protein of Human interleukin 1, alpha (IL1A).

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
• Tag: Tag Free
• Predicted MW: 18 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 as determined by the dose-dependent stimulation of murine D10S cells is less than or equal to 0.001 ng/ml, corresponding to a specific activity of > 1 x 10^9 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000566
• Locus ID: 3552
• UniProt ID: P01583
• Cytogenetics: 2q14.1
• Refseq Size: 2943
• Refseq ORF: 813
• Synonyms: IL-1 alpha; IL-1A; IL1; IL1-ALPHA; IL1F1
• Summary: 'The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Apoptosis, Cytokine-cytokine receptor interaction, Graft-versus-host disease, Hematopoietic cell lineage, MAPK signaling pathway, Prion diseases, Type I diabetes mellitus