IL6 (NM_000600) Human Recombinant Protein
CAT#: TP723240
Purified recombinant protein of Human interleukin 6 (interferon, beta 2) (IL6).
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
|
| Tag | Tag Free |
| Predicted MW | 20.9 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | ED50 as determined by the dose-dependent stimulation of the proliferation of IL-6 dependent murine 7TD1 cells is less than or equal to 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7units/mg. Cell treatment (PMID: 28068414) |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000591 |
| Locus ID | 3569 |
| UniProt ID | P05231, Q75MH2, B4DVM1 |
| Cytogenetics | 7p15.3 |
| Refseq Size | 1201 |
| Refseq ORF | 636 |
| Synonyms | BSF-2; BSF2; CDF; HGF; HSF; IFN-beta-2; IFNB2; IL-6 |
| Summary | 'This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2). [provided by RefSeq, Aug 2020]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Graft-versus-host disease, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), Jak-STAT signaling pathway, NOD-like receptor signaling pathway, Pathways in cancer, Prion diseases, Toll-like receptor signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424617 | IL6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY424617 | Transient overexpression lysate of interleukin 6 (interferon, beta 2) (IL6) |
USD 436.00 |
|
| PH302078 | IL6 MS Standard C13 and N15-labeled recombinant protein (NP_000591) |
USD 2,055.00 |
|
| TP302078 | Recombinant protein of human interleukin 6 (interferon, beta 2) (IL6) |
USD 823.00 |
|
| TP720008 | Recombinant protein of human interleukin 6 (interferon, beta 2) (IL6), the mature form (Pro29-Met212) with C-terminal His tag |
USD 330.00 |
|
| TP723713 | Purified recombinant protein of Human interleukin 6 (interferon, beta 2) (IL6) |
USD 205.00 |
|
| TP750006 | Recombinant protein of human Interleukin 6(IL-6) produced in E. coli. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China