Melanoma Inhibitory Activity (MIA) (NM_006533) Human Recombinant Protein

CAT#: TP723296

Purified recombinant protein of Human melanoma inhibitory activity (MIA), transcript variant 1.

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
• Tag: Tag Free
• Predicted MW: 12.2 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by the dose-dependant proliferation of the human A375 melanoma cell line. The expected ED50 for this effect is 4-6ug/mL.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006524
• Locus ID: 8190
• UniProt ID: Q16674, A0A024R0P1
• Cytogenetics: 19q13.2
• Refseq Size: 654
• Refseq ORF: 393
• Synonyms: CD-RAP
• Summary: Elicits growth inhibition on melanoma cells in vitro as well as some other neuroectodermal tumors, including gliomas. [UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein, Transmembrane