Melanoma Inhibitory Activity (MIA) (NM_006533) Human Recombinant Protein

CAT#: TP303245

Recombinant protein of human melanoma inhibitory activity (MIA)

Product Images

Coomassie blue staining of purified MIA protein (Cat# TP303245). The protein was produced from HEK293T cells transfected with MIA cDNA clone (Cat# RC203245) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203245 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVV
  YVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006524
• Locus ID: 8190
• UniProt ID: Q16674, A0A024R0P1
• Cytogenetics: 19q13.2
• Refseq Size: 654
• Refseq ORF: 393
• Synonyms: CD-RAP
• Summary: Elicits growth inhibition on melanoma cells in vitro as well as some other neuroectodermal tumors, including gliomas.[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein, Transmembrane