Macrophage Inflammatory Protein 1 beta (CCL4) (NM_002984) Human Recombinant Protein

CAT#: TP723306

Purified recombinant protein of human chemokine (C-C motif) ligand 4 (CCL4)

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  APMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
• Tag: Tag Free
• Predicted MW: 7.6 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >98% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract human blood monocytes using a concentration range of 5.0-20.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002975
• Locus ID: 6351
• UniProt ID: P13236
• Cytogenetics: 17q12
• Refseq Size: 667
• Refseq ORF: 276
• Synonyms: ACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
• Summary: 'The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. [provided by RefSeq, Dec 2012]'
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Toll-like receptor signaling pathway