Macrophage Inflammatory Protein 1 beta (CCL4) (NM_002984) Human Recombinant Protein

CAT#: TP310481

Recombinant protein of human chemokine (C-C motif) ligand 4 (CCL4), transcript variant 1

Product Images

Coomassie blue staining of purified CCL4 protein (Cat# TP310481). The protein was produced from HEK293T cells transfected with CCL4 cDNA clone (Cat# RC210481) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210481 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRS
  KQVCADPSESWVQEYVYDLELN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002975
• Locus ID: 6351
• UniProt ID: P13236
• Cytogenetics: 17q12
• Refseq Size: 667
• Refseq ORF: 276
• Synonyms: ACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
• Summary: The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. [provided by RefSeq, Dec 2012]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Toll-like receptor signaling pathway