alpha Defensin 1 (DEFA1) (NM_004084) Human Recombinant Protein
CAT#: TP723336
Purified recombinant protein of Human defensin, alpha 1 (DEFA1).
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
ACYCRIPACIAGERRYGYCIYQGRLWAFCC
|
Tag | Tag Free |
Predicted MW | 3.4 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract immature dendritic cells using a concentration of 1.0-10.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004075 |
Locus ID | 1667 |
UniProt ID | P59665 |
Cytogenetics | 8p23.1 |
Refseq Size | 490 |
Refseq ORF | 282 |
Synonyms | DEF1; DEFA2; HNP-1; HP-1; HP1; MRS |
Summary | 'Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation. [provided by RefSeq, Oct 2014]' |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418227 | DEFA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418227 | Transient overexpression lysate of defensin, alpha 1 (DEFA1) |
USD 396.00 |
|
PH318421 | DEFA1 MS Standard C13 and N15-labeled recombinant protein (NP_004075) |
USD 2,055.00 |
|
TP318421 | Recombinant protein of human defensin, alpha 1 (DEFA1) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review