Pdgfb (NM_011057) Mouse Recombinant Protein

CAT#: TP723356

Purified recombinant protein of Mouse platelet derived growth factor, B polypeptide (Pdgfb).

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
• Tag: Tag Free
• Predicted MW: 24.4 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells. The expected ED50 for this effect is 1.0-2.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_035187
• Locus ID: 18591
• UniProt ID: P31240, A0A0R4IZW4
• Cytogenetics: 15 37.85 cM
• Refseq Size: 2956
• Refseq ORF: 723
• Synonyms: c-sis; PDGF-2; PDGF-B; Sis