Retnlb (NM_023881) Mouse Recombinant Protein

CAT#: TP723380

Purified recombinant protein of Mouse resistin like beta (Retnlb).

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA
• Tag: Tag Free
• Predicted MW: 18 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_076370
• Locus ID: 57263
• UniProt ID: Q99P86, A0A0R4J042
• Cytogenetics: 16 30.75 cM
• Refseq Size: 718
• Refseq ORF: 318
• Synonyms: 9030012B21Rik; Fizz2; Relmb; RELMbeta; Xcp3
• Summary: Probable hormone. [UniProtKB/Swiss-Prot Function]