Tnfsf11 (NM_011613) Mouse Recombinant Protein

CAT#: TP723422

Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 11 (Tnfsf11).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  PAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
• Tag: Tag Free
• Predicted MW: 19.4 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its dose-dependent ability to induce reporter gene in HT-29 NF-kB Luc reporter cells.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_035743
• Locus ID: 21943
• UniProt ID: O35235
• Cytogenetics: 14 41.26 cM
• Refseq Size: 2243
• Refseq ORF: 951
• Synonyms: Ly109l; ODF; OPGL; RANKL; Trance