Tnfsf11 (NM_057149) Rat Recombinant Protein

CAT#: TP723423

Purified recombinant protein of Rat tumor necrosis factor (ligand) superfamily, member 11 (Tnfsf11).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  PAMMEGSWLDVARRGKPEAQPFAHLTINAADIPSGSHKVSLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPADYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISVQVSNPSLLDPDQDATYFGAFKVQDID
• Tag: Tag Free
• Predicted MW: 19.4 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to induce NFkB in RAW264.7 cells in the absence of any cross-linking. The expected ED50 for this effect is 10.0-25.0 ng/ml.
  Cell culture factor (PMID: 30022569)
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_476490
• Locus ID: 117516
• UniProt ID: Q9ESE2
• Cytogenetics: 15q11
• Refseq Size: 957
• Refseq ORF: 954
• Synonyms: RANKL
• Summary: induces osteoclast formation and bone resoprtion; plays a role in regulation of calcium homeostasis and osteoclast function [RGD, Feb 2006]