Tnfsf11 (NM_057149) Rat Recombinant Protein

CAT#: TP723423

Purified recombinant protein of Rat tumor necrosis factor (ligand) superfamily, member 11 (Tnfsf11).


  View other "Tnfsf11" proteins (2)

USD 240.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "Tnfsf11"

Specifications

Product Data
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence
PAMMEGSWLDVARRGKPEAQPFAHLTINAADIPSGSHKVSLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPADYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISVQVSNPSLLDPDQDATYFGAFKVQDID
Tag Tag Free
Predicted MW 19.4 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to induce NFkB in RAW264.7 cells in the absence of any cross-linking. The expected ED50 for this effect is 10.0-25.0 ng/ml.
Cell culture factor (PMID: 30022569)
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_476490
Locus ID 117516
UniProt ID Q9ESE2
Cytogenetics 15q11
Refseq Size 957
Refseq ORF 954
Synonyms RANKL
Summary induces osteoclast formation and bone resoprtion; plays a role in regulation of calcium homeostasis and osteoclast function [RGD, Feb 2006]

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.