TGF alpha (TGFA) (NM_003236) Human Recombinant Protein

CAT#: TP723437

Purified recombinant protein of Human transforming growth factor, alpha (TGFA), transcript variant 1.

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
• Tag: Tag Free
• Predicted MW: 5.5 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 as determined by the dose-dependent stimulation of thymidine uptake by BALB/c 3T3 cells is less than or equal to 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003227
• Locus ID: 7039
• UniProt ID: P01135
• Cytogenetics: 2p13.3
• Refseq Size: 4326
• Refseq ORF: 507
• Synonyms: TFGA
• Summary: This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: ErbB signaling pathway, Glioma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Renal cell carcinoma