TIMP1 (NM_003254) Human Recombinant Protein
CAT#: TP723447
Purified recombinant protein of Human TIMP metallopeptidase inhibitor 1 (TIMP1).
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
|
| Tag | Tag Free |
| Predicted MW | 20.6 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | TIMP1 activity was measured by its ability to inhibit human MMP-1 induced hydrolysis of a chromogenic peptide substrate at room temperature. Half maximal inhibition was obtained at a TIMP-1 concentration of approximately 0.5 ug/mL, when using an MMP-1 concentration of 1.6ug/mL. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_003245 |
| Locus ID | 7076 |
| UniProt ID | P01033, Q6FGX5 |
| Cytogenetics | Xp11.3 |
| Refseq Size | 931 |
| Refseq ORF | 621 |
| Synonyms | CLGI; EPA; EPO; HCI; TIMP; TIMP-1 |
| Summary | 'This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promote cell proliferation in a wide range of cell types, and may also have an anti-apoptotic function. Transcription of this gene is highly inducible in response to many cytokines and hormones. In addition, the expression from some but not all inactive X chromosomes suggests that this gene inactivation is polymorphic in human females. This gene is located within intron 6 of the synapsin I gene and is transcribed in the opposite direction. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418808 | TIMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY418808 | Transient overexpression lysate of TIMP metallopeptidase inhibitor 1 (TIMP1) |
USD 436.00 |
|
| TP720383 | Recombinant protein of human TIMP metallopeptidase inhibitor 1 (TIMP1) |
USD 330.00 |
|
| TP723878 | Purified recombinant protein of Human TIMP metallopeptidase inhibitor 1 (TIMP1) |
USD 270.00 |
|
| TP761577 | Purified recombinant protein of Human TIMP metallopeptidase inhibitor 1 (TIMP1), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China