Thrombopoietin (THPO) (NM_000460) Human Recombinant Protein

CAT#: TP723455

Purified recombinant protein of Human thrombopoietin (THPO), transcript variant 1.

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL
• Tag: Tag Free
• Predicted MW: 18.6 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be < 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000451
• Locus ID: 7066
• UniProt ID: P40225
• Cytogenetics: 3q27.1
• Refseq Size: 1805
• Refseq ORF: 1059
• Synonyms: MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
• Summary: 'Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent. [provided by RefSeq, Feb 2014]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Hematopoietic cell lineage