Antibodies

Jump to Filters
View as table Download
Thrombopoietin (THPO) Rabbit Polyclonal Antibody
TA323653

USD 345.00

4 Weeks

Anti-THPO Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 22-349 amino acids of human Thrombopoietin
Thrombopoietin (THPO) Rabbit Polyclonal Antibody
TA344223

USD 475.00

5 Days

Rabbit Polyclonal Anti-THPO Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THPO antibody: synthetic peptide directed towards the middle region of human THPO. Synthetic peptide located within the following region: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS
Thrombopoietin (THPO) Rabbit Polyclonal Antibody
TA344224

USD 475.00

5 Days

Rabbit Polyclonal Anti-THPO Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THPO antibody: synthetic peptide directed towards the middle region of human THPO. Synthetic peptide located within the following region: HELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP
Thrombopoietin (THPO) Goat Polyclonal Antibody
TA328461

USD 285.00

5 Days

Anti-Human TPO Goat Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TPO
Thrombopoietin (THPO) Rabbit Polyclonal Antibody
TA317418

USD 425.00

5 Days

Thrombopoietin Rabbit Polyclonal (aa35-50) Antibody

Applications IHC
Reactivities Human
Immunogen THPO / TPO / Thrombopoietin antibody was raised against synthetic peptide from human THPO / Thrombopoietin.
Thrombopoietin (THPO) Rabbit Polyclonal Antibody
TA319079

USD 355.00

3 Weeks

Rabbit polyclonal anti-THPO (TPO) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human TPO
Thrombopoietin (THPO) Goat Polyclonal Antibody
TA328460

USD 285.00

5 Days

Biotinylated Anti-Human TPO Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TPO
Thrombopoietin (THPO) Rabbit Polyclonal Antibody
TA388917

USD 350.00

5 Days

TPO Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Produced from sera of rabbits pre-immunized with highly pure (>98%) recombinant hTPO. Anti-Human TPO specific antibody was purified by affinity chromatography employing immobilized hTPO matrix.
Thrombopoietin (THPO) Rabbit Polyclonal Antibody
TA388918

USD 350.00

5 Days

TPO Antibody (biotin)

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Produced from sera of rabbits pre-immunized with highly pure (>98%) recombinant hTPO. Anti-Human TPO specific antibody was purified by affinity chromatography and then biotinylated.