Thrombopoietin (THPO) Rabbit Polyclonal Antibody

CAT#: TA344223

Rabbit Polyclonal Anti-THPO Antibody - middle region

Product Images

WB Suggested Anti-THPO Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-THPO antibody: synthetic peptide directed towards the middle region of human THPO. Synthetic peptide located within the following region: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: thrombopoietin
• Database Link:
  NP_000451
  Entrez Gene 7066 Human
  UniProt ID P40225
• Background: Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 90%; Dog: 83%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Hematopoietic cell lineage