Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Rabbit Polyclonal Anti-NONO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
Rabbit Polyclonal Anti-CENPN Antibody - middle region
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CENPN antibody: synthetic peptide directed towards the middle region of human CENPN. Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS |
Rabbit Polyclonal Anti-PPP1R10 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R10 antibody: synthetic peptide directed towards the N terminal of human PPP1R10. Synthetic peptide located within the following region: SQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKP |
Rabbit Polyclonal Anti-NONO Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the N terminal of human NONO. Synthetic peptide located within the following region: KQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLK |
Rabbit Polyclonal Anti-NUP98 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUP98 antibody: synthetic peptide directed towards the N terminal of human NUP98. Synthetic peptide located within the following region: AFGTSAFGSSNNTGGLFGNSQTKPGGLFGTSSFSQPATSTSTGFGFGTST |
Rabbit Polyclonal Anti-PABPN1 Antibody
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PABPN1 antibody: synthetic peptide directed towards the N terminal of human PABPN1. Synthetic peptide located within the following region: MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL |
Rabbit Polyclonal Anti-SF3A1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SF3A1 antibody: synthetic peptide directed towards the N terminal of human SF3A1. Synthetic peptide located within the following region: QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT |
Germany
Japan
United Kingdom
China
