NONO Rabbit Polyclonal Antibody

CAT#: TA343779

Rabbit Polyclonal Anti-NONO Antibody

Product Images

WB Suggested Anti-NONO Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

• 

  Human kidney

• 

  Human Liver

• 

  Rabbit Anti-NONO Antibody; Paraffin Embedded Tissue: Human cardiac cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-NONO Antibody; Paraffin Embedded Tissue: Human cardiac cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Sample Type: subnuclear bodies-paraspeckles;

Show all 6 images

Specifications

Product Data

• Applications: IF, IHC, WB
• Recommended Dilution: WB, IHC, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: non-POU domain containing, octamer-binding
• Database Link:
  NP_031389
  Entrez Gene 4841 Human
  UniProt ID Q15233
• Background: NONO is DNA- and RNA binding protein, involved in several nuclear processes. It binds the conventional octamer sequence in double stranded DNA. It also binds single-stranded DNA and RNA at a site independent of the duplex site. It is involved in pre-mRNA splicing and interacts with U5 snRNA. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs, be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1 and be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription.
• Synonyms: MRXS34; NMT55; NRB54; P54; P54NRB; PPP1R114
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors