Antibodies for $/€ 289

Jump to Filters
View as table Download
Vitronectin (VTN) Rabbit Polyclonal Antibody
TA344462

USD 475.00

5 Days

Rabbit Polyclonal Anti-VTN Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VTN antibody: synthetic peptide directed towards the N terminal of human VTN. Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE
Vitronectin (VTN) Rabbit Polyclonal Antibody
TA346045

USD 475.00

5 Days

Rabbit Polyclonal Anti-Vtn Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Vtn antibody is: synthetic peptide directed towards the middle region of Rat Vtn. Synthetic peptide located within the following region: EELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQDVWGI