Antibodies for $/€ 289

Jump to Filters
View as table Download
EIF3E Rabbit Polyclonal Antibody
TA346552

USD 475.00

5 Days

Rabbit Polyclonal Anti-EIF3E Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF3E antibody: synthetic peptide directed towards the N terminal of human EIF3E. Synthetic peptide located within the following region: ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ
EIF3E Rabbit Polyclonal Antibody
TA346553

USD 475.00

5 Days

Rabbit Polyclonal Anti-EIF3E Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF3E antibody: synthetic peptide directed towards the middle region of human EIF3E. Synthetic peptide located within the following region: LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK