Rabbit Polyclonal Anti-SCYL3 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Scyl3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGLSDVKNTSEDNGSFPAGSNKPEEWPDWSEPEEPEQQPASIHRWPREPC |
Rabbit Polyclonal Anti-SCYL3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCYL3 antibody: synthetic peptide directed towards the N terminal of human SCYL3. Synthetic peptide located within the following region: MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV |
Germany
Japan
United Kingdom
China