Rabbit Polyclonal Anti-GPX4 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA |
Rabbit Polyclonal Anti-GPX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI |
Rabbit Polyclonal Anti-CYP4F3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4F3 antibody: synthetic peptide directed towards the N terminal of human CYP4F3. Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF |
Rabbit Polyclonal Anti-CYP4A22 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
Rabbit Polyclonal Anti-PTGDS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGDS antibody: synthetic peptide directed towards the N terminal of human PTGDS. Synthetic peptide located within the following region: MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS |
Rabbit Polyclonal Anti-PGDS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGDS antibody: synthetic peptide directed towards the N terminal of human PGDS. Synthetic peptide located within the following region: EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME |
Germany
Japan
United Kingdom
China
