Antibodies for $/€ 289

Jump to Filters
View as table Download
IGF2BP1 Rabbit Polyclonal Antibody
TA344358

USD 475.00

5 Days

Rabbit Polyclonal Anti-IGF2BP1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-IGF2BP1 antibody: synthetic peptide directed towards the N terminal region of human IGF2BP1. Synthetic peptide located within the following region: AFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPP
IGF2BP1 Rabbit Polyclonal Antibody
TA345972

USD 475.00

5 Days

Rabbit Polyclonal Anti-IGF2BP1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IGF2BP1 antibody: synthetic peptide directed towards the N terminal of human IGF2BP1. Synthetic peptide located within the following region: PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT