Rabbit Polyclonal Anti-PML Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PML antibody: synthetic peptide directed towards the middle region of human PML. Synthetic peptide located within the following region: TTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQ |
Rabbit Polyclonal Anti-KEAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1. Synthetic peptide located within the following region: HTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC |
Rabbit Polyclonal Anti-PIAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the middle region of human PIAS1. Synthetic peptide located within the following region: LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISL |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE |
Rabbit Polyclonal Anti-UBE2K Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the middle region of human UBE2K. Synthetic peptide located within the following region: TVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPV |
Rabbit Polyclonal Anti-UBE2K Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the N terminal of human UBE2K. Synthetic peptide located within the following region: FTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNIS |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: VRRASGCLITLDQHNGKKSQAVESANTAHNGKVNGLCFTSDGLHLLTVGT |
Rabbit Polyclonal Anti-ERCC8 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the N terminal of human ERCC8. Synthetic peptide located within the following region: DLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSFD |
Rabbit Polyclonal Anti-PIAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the N terminal of human PIAS1. Synthetic peptide located within the following region: MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCS |
Germany
Japan
United Kingdom
China
