Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAP3 antibody: synthetic peptide directed towards the N terminal of human LAP3. Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN |
Rabbit Polyclonal Anti-GPX4 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA |
Rabbit Polyclonal Anti-GSTM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTM2 antibody: synthetic peptide directed towards the N terminal of human GSTM2. Synthetic peptide located within the following region: TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF |
Rabbit Polyclonal Anti-GPX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI |
Rabbit Polyclonal Anti-GSTT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTT1 antibody: synthetic peptide directed towards the C terminal of human GSTT1. Synthetic peptide located within the following region: TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR |
Rabbit Polyclonal Anti-G6PD Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PD antibody: synthetic peptide directed towards the middle region of human G6PD. Synthetic peptide located within the following region: VTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRI |
Rabbit Polyclonal Anti-GSTP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSTP1 antibody is: synthetic peptide directed towards the N-terminal region of Human GSTP1. Synthetic peptide located within the following region: TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQ |
Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Lap3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD |
Rabbit Polyclonal Anti-GSTM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the N terminal of human GSTM1. Synthetic peptide located within the following region: KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI |
Rabbit Polyclonal Anti-GSTM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the C terminal of human GSTM1. Synthetic peptide located within the following region: PEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK |
Rabbit Polyclonal Anti-GPX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPX2 antibody: synthetic peptide directed towards the middle region of human GPX2. Synthetic peptide located within the following region: GGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLII |
Rabbit Polyclonal Anti-GSTA3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTA3 antibody: synthetic peptide directed towards the middle region of human GSTA3. Synthetic peptide located within the following region: SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR |
Rabbit Polyclonal Anti-GSTM5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTM5 antibody: synthetic peptide directed towards the N terminal of human GSTM5. Synthetic peptide located within the following region: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK |
Rabbit Polyclonal Anti-GSTA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTA4 antibody: synthetic peptide directed towards the C terminal of human GSTA4. Synthetic peptide located within the following region: LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP |
Germany
Japan
United Kingdom
China
