Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Rabbit Polyclonal Anti-HHEX Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HHEX antibody: synthetic peptide directed towards the C terminal of human HHEX. Synthetic peptide located within the following region: DQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKS |
Rabbit Polyclonal Anti-IAPP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IAPP antibody: synthetic peptide directed towards the N terminal of human IAPP. Synthetic peptide located within the following region: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV |
Germany
Japan
United Kingdom
China
