HNF1 alpha (HNF1A) Rabbit Polyclonal Antibody

CAT#: TA344549

Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region

Product Images

WB Suggested Anti-HNF1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human kidney

• 

  Host: Rabbit; Target Name: HNF1A; Sample Tissue: Human Fetal Stomach; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: HNF1A; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: HNF1A; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Sample Type: Human Liver Carcinoma (HepG2 lysate)10-40ug lysate/lanePrimary Dilution: 1:1000Secondary: Alexa Fluor 680 Donkey Anti-Rabbit IgG Invitrogen Secondary Dilution: 1:30,000HNF1A is strongly supported by BioGPS gene expression data to be expressed

Show all 5 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: HNF1 homeobox A
• Database Link:
  NP_000536
  Entrez Gene 6927 Human
  UniProt ID P20823
• Background: HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.
• Synonyms: HNF-1A; HNF1; IDDM20; LFB1; MODY3; TCF-1; TCF1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 86%

Reference Data

• Protein Families: Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young