Rabbit Polyclonal Anti-NR2E3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2E3 antibody: synthetic peptide directed towards the N terminal of human NR2E3. Synthetic peptide located within the following region: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVC |
Rabbit Polyclonal Anti-NR2E3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NR2E3 antibody is: synthetic peptide directed towards the C-terminal region of Human NR2E3. Synthetic peptide located within the following region: EHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELL |
Germany
Japan
United Kingdom
China