Rabbit Polyclonal Anti-SFPQ Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFPQ antibody: synthetic peptide directed towards the N terminal of human SFPQ. Synthetic peptide located within the following region: VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE |
Rabbit Polyclonal Anti-SFPQ Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFPQ antibody: synthetic peptide directed towards the middle region of human SFPQ. Synthetic peptide located within the following region: PVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQR |
Germany
Japan
United Kingdom
China
